PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bradi2g23320.5.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Brachypodieae; Brachypodium
Family MYB
Protein Properties Length: 603aa    MW: 67125.1 Da    PI: 7.4469
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bradi2g23320.5.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding53.94.1e-1754100148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g WT+eEde l +av  + g++Wk+Ia+ ++  Rt+ qc +rwqk+l
  Bradi2g23320.5.p  54 KGGWTPEEDETLRKAVYAFKGKNWKKIAESFP-DRTEVQCLHRWQKVL 100
                       688*****************************.************986 PP

2Myb_DNA-binding61.22.2e-19106152148
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 
                       +g+WT+eEd+ +vd vk++G++ W++Ia+ +  gR +kqc++rw+++l
  Bradi2g23320.5.p 106 KGPWTQEEDDTIVDMVKKHGPRKWSLIAKSLD-GRIGKQCRERWHNHL 152
                       79******************************.*************97 PP

3Myb_DNA-binding63.25e-20158200145
                       TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS
   Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 
                       + +WTteE++ lv+a++++G++ W+ Ia+ ++ gRt++++k++w+
  Bradi2g23320.5.p 158 KEAWTTEEEQVLVKAHHLHGNR-WAEIAKLLP-GRTDNSIKNHWN 200
                       579*******************.*********.***********8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129415.71149100IPR017930Myb domain
SMARTSM007171.1E-1453102IPR001005SANT/Myb domain
PfamPF002492.0E-1554100IPR001005SANT/Myb domain
SuperFamilySSF466892.15E-1555110IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.2E-2456117IPR009057Homeodomain-like
CDDcd001676.12E-1357100No hitNo description
PROSITE profilePS5129431.468101156IPR017930Myb domain
SuperFamilySSF466892.85E-31103199IPR009057Homeodomain-like
SMARTSM007176.6E-17105154IPR001005SANT/Myb domain
PfamPF002491.8E-17106152IPR001005SANT/Myb domain
CDDcd001676.82E-15108152No hitNo description
Gene3DG3DSA:1.10.10.608.8E-27118160IPR009057Homeodomain-like
SMARTSM007171.7E-17157205IPR001005SANT/Myb domain
PROSITE profilePS5129423.561157207IPR017930Myb domain
PfamPF002491.0E-17158201IPR001005SANT/Myb domain
CDDcd001678.62E-14160200No hitNo description
Gene3DG3DSA:1.10.10.604.5E-23161206IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 603 aa     Download sequence    Send to blast
MVLTLLLLGF QIGKNRFKWG GKCLLPKTTS TVSIYIPWGY YLSRRTSGPV RRAKGGWTPE  60
EDETLRKAVY AFKGKNWKKI AESFPDRTEV QCLHRWQKVL DPELIKGPWT QEEDDTIVDM  120
VKKHGPRKWS LIAKSLDGRI GKQCRERWHN HLDPQIRKEA WTTEEEQVLV KAHHLHGNRW  180
AEIAKLLPGR TDNSIKNHWN SSVRKRIDDY STRTVMPVPL HATHIDLKHA AELSSAENHI  240
DLNKEPSISL KDRPVIVDHS DLIQSPRVCS LKNIKGCSDF LSLAMPTAQP LTLCEASVSD  300
DSAVALAIMG LKMDSGHDKD MQLKCVSENS LEISLSNERG LKIDLITNKM RPSGLGKSEG  360
EIANIGCESP SQNEAGSLGS LCYWIPMLDD TDLAHSPVFS THNVRENSGI GFQSPTGYTT  420
PSPTEGKKSD QLSVESILKS AAENFPSTPS ILRRRKREKP TPAQDCELRI ETNSDSFETP  480
IGNFTTDSPH SFKTASFLSF SHLDDQGLPA DLGKCDVSPS YRLRSKRMAV LKTIEKHLDF  540
SSDAMDICDT SGVLKSACRN SESINSSTDI SSVEDEKMGA GHMIGLETLI NDFAHTRKLD  600
AS*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h88_C3e-68532075159MYB PROTO-ONCOGENE PROTEIN
1h89_C3e-68532075159MYB PROTO-ONCOGENE PROTEIN
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1452459RRRKREKP
2453458RRKREK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_003568309.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
RefseqXP_010231305.10.0PREDICTED: cyclin-D-binding Myb-like transcription factor 1 isoform X1
TrEMBLA0A0Q3K5700.0A0A0Q3K570_BRADI; Uncharacterized protein
STRINGBRADI2G23320.10.0(Brachypodium distachyon)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G02320.22e-95myb domain protein 3r-5